DPCstruct | MC49502
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 192 ± 21 aa |
| Standard deviation of domain lengths | 21.46 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G4L8Y5 | 19-223 | KMIGRGCISITTRYARAIRAVGLEIITIRKGPEPPKSLFVLSRKAALARCIVHLLPAMISIILISINLMGYFIGTRLQGWRGSDSIK… |
| A0A3N4KAB6 | 13-211 | VKSYSITPNVEKKKSVFSSKTLRCVYWHIPAIISCLGTGVLFFLNFSEYSIGAEVGKTTRQTRNIIGALQLAAKLHEMIIISSLANI… |
| A0A175W3W2 | 100-284 | None |
| A0A094AA05 | 98-306 | None |
| A0A2V1BLJ0 | 12-216 | None |
| A0A094FDY2 | 99-274 | None |
| A0A0U5C5H0 | 48-204 | None |
| A0A1L7XKF7 | 100-280 | None |
| A0A4T0W886 | 2-161 | None |
| A0A1L7WS60 | 14-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.