DPCstruct | MC49501
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 113 ± 14 aa |
| Standard deviation of domain lengths | 14.30 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 50.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05020- CL0366 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H8TTW0 | 36-129 | CAGHLPWPKGICSKCQPSAITLNRQTYRHVDNVMFENSELVERFLNYWRITGHQRIGFLYGRYEMHPDIPLGIRAVVAAIYEPPQES… |
| A0A5B0NQC6 | 50-159 | LEELDYKVDIPCPSASHAPFPAGICSKCQPSAITLQLQPYRMVDHVEFATPALIENMLVFWRKTGCQRFGYMLGRYERYDQVPLGIK… |
| A0A3P6T0W6 | 4-129 | None |
| A0A6V7X7B2 | 40-162 | None |
| G8BJD6 | 51-139 | None |
| A0A1I7Z0Q5 | 55-179 | None |
| A0A0N4Y2T3 | 62-185 | None |
| A0A4V3XIA3 | 29-161 | None |
| A0A3S5AQY6 | 20-133 | None |
| A0A0W4ZLP7 | 51-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.