DPCstruct | MC4950
Metacluster Properties and Pfam Annotations
| Number of structural domains | 111 |
|---|---|
| Mean domain length (aa) | 184 ± 45 aa |
| Standard deviation of domain lengths | 44.77 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 78.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 31.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03181 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K3PFQ2 | 10-197 | FLSREVANSIPFSSNKVEMENILNHFSIKQGSKECEFVKNTIGYCEGQDMKGEVKTCVTSLESMVDFATLKLGNNVEAVSTEVNKET… |
| A0A0V0HWB9 | 116-325 | FFRVSILKPGNTIHLDNLVNPFPHRSFLPSQIASKISINSNHLQHLFPQTFTSPFTKDTTETTILNCNAPTLKGEVKTCAKSLEEMI… |
| A0A803Q9M5 | 245-473 | None |
| A0A445CVP8 | 105-329 | None |
| A0A1U8F4M6 | 34-221 | None |
| A0A5N6P356 | 84-293 | None |
| A0A5D2JTU8 | 615-840 | None |
| A0A803L4S4 | 23-235 | None |
| A0A2N9H0T9 | 287-510 | None |
| B9RIH5 | 103-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.