DPCstruct | MC495
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 108 ± 6 aa |
| Standard deviation of domain lengths | 6.32 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 80.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G4T7M9 | 1-112 | MCHDGNSATQSVRYLNAQLTALYQNAYECVHDCEDSLDFTSVEYDKSKYNRSLAQWHFVPKPKKVFSTAELFFSAHFEQPKLIFICN… |
| A0A286UTT4 | 1-107 | MCLGNRARAASDYVNGQLRTLYDNSLYYVEHHGTGSRPTETGIEYATCPAEFYGPGKHRHQRSTTDLTFFAKFGQPRVEFICNHELI… |
| A0A4Y9XQD4 | 439-550 | None |
| K5UVH0 | 19-127 | None |
| B8P4L2 | 1-113 | None |
| A0A0D0BBL6 | 1-93 | None |
| A0A4S4LD66 | 1-105 | None |
| A0A4S4KEJ1 | 192-308 | None |
| A0A165MBF6 | 1-103 | None |
| A0A2R6NS56 | 56-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.