DPCstruct | MC49497
Metacluster Properties and Pfam Annotations
| Number of structural domains | 456 |
|---|---|
| Mean domain length (aa) | 131 ± 23 aa |
| Standard deviation of domain lengths | 22.88 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.91 |
| Pfam Score | 53.80 |
| Assigned Pfam label(s) | CL0196- CL0263- CL0081- CL0229- PF19060 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A084ACA5 | 2-107 | EMKQIPDYPNYAVTKDGRVWSYNRNKFIKLRVSKENSVIVNLSFEGIRFRRNVARLVFIAFKGYEPEIVRHKDNNPTNNCLKNLEGI… |
| A0A0F0CGH1 | 28-156 | IEPIAEDEVFVQLLDHKDSWISNYGRAVSFYNGKYFLTRKKINKDGEICYQLNRNVFDGRNWVWKKQVIEAWKLVVKEFTVNYDISN… |
| A0A2G5EAV0 | 184-356 | None |
| A0A397S736 | 6-148 | None |
| A0A1G7ZRW3 | 294-412 | None |
| R1D6B8 | 13-165 | None |
| R1D116 | 233-363 | None |
| A0A7K0KJ81 | 7-123 | None |
| A0A495SMJ8 | 41-194 | None |
| A0A4V1BJ06 | 33-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.