DPCstruct | MC49496
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 288 ± 23 aa |
| Standard deviation of domain lengths | 23.11 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 16.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0287- PF20610 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A415PEK7 | 19-297 | GYTLVDYDNCVSYADVFSGVDDGMGDWKSWEFSVEEPDGDVVKAMCAEPHKTQPVIGSTFTDGGTYVNDTVARVFFFSVGSGASRGP… |
| A0A523TYL3 | 21-287 | VMAGDGPSVNLPEDPVSVRIYQSPYAYTLTRLSDVPEGYDVTNTGYKGWCVDITQLVYLWWPYTATLYSSCGEEILTVFPKYEAGDW… |
| J9CLD6 | 1-264 | None |
| D4JNU6 | 21-316 | None |
| A0A174T4W8 | 13-269 | None |
| R6RGJ7 | 332-640 | None |
| A0A5F0UYT2 | 24-346 | None |
| A0A1Q9JGJ2 | 39-348 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.