DPCstruct | MC4949
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 137 ± 12 aa |
| Standard deviation of domain lengths | 12.20 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L9TAQ2 | 1-124 | MADVREQISGEGGPYAPVNWPEEGDVWRWKTGTKVTSSGKYYKHRSLHLPPRLFAILEEEERREKTSLTKVFKSKVTFTRYIERYFP… |
| A0A2K3PAR1 | 1-129 | MAKNNRHNNDPTGLNLPPVAADQIGQGLPYAPINFPEQGDVWGWKTGKRLQPNGCFQDRYLYLPERLSSGSDSKDQHTFRSKLSVER… |
| A0A2Z6PHN7 | 1-120 | None |
| A0A067G4M6 | 7-135 | None |
| A0A6V7QYN8 | 13-147 | None |
| Q94GQ3 | 229-359 | None |
| A0A811N2P1 | 176-314 | None |
| A0A7J9GJ54 | 52-201 | None |
| A0A2Z6PFV2 | 1-140 | None |
| A0A438F7D1 | 50-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.