DPCstruct | MC49489
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 203 ± 23 aa |
| Standard deviation of domain lengths | 23.31 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4IWF4 | 3-168 | SLHAIFEAYAASGDDGSAAGRVNASYVSVAEFLDMMRDMRFIDNDFTTREATLAFVWSRMRVIDELKESTRKKVEQISFEDWLEVLV… |
| A0A7S0UYK9 | 375-570 | PNKFRAERMYTPEMDVLIARHFELLRAAFKLYKARDRTKYFWIEHWFAFLDGTKLLGLHTGVERREAKLIFVWAQMTVTDELKRRRR… |
| A0A7S2V5D6 | 9-180 | None |
| A0A7S2MN54 | 1-215 | None |
| A0A7S4I679 | 1-239 | None |
| A0A7S4IHN2 | 1-203 | None |
| A0A0M0K3C2 | 507-732 | None |
| A0A7S2WT26 | 12-181 | None |
| A0A7S0RTF8 | 384-593 | None |
| A0A7S3B3Q8 | 100-307 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.