DPCstruct | MC49488
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 168 ± 16 aa |
| Standard deviation of domain lengths | 15.67 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4IJR8 | 4-170 | GSLLCDEQKEVITRLWESIQAPDRGGLPSRINEEWFSATFCNGKVLEKDRSAWEHVDDVMLYNPLVLLAAIPAVEERYFASTRVKVR… |
| A0A7S2RFQ2 | 43-173 | CNIRNVSESNLMKLWKKVNLAPSDPRREKLPDRCNREWFCRTFIEKDDVDEDKSIWNQITKVNLYDPLALLACVPAFREMHFEWKTK… |
| A0A7S2FEM8 | 1-196 | None |
| A0A7S4HKK2 | 250-427 | None |
| A0A7S4NKV7 | 1-157 | None |
| K0TPZ8 | 69-231 | None |
| R1E285 | 449-612 | None |
| F0YEM4 | 583-753 | None |
| A0A7S3B8R3 | 862-1043 | None |
| A0A7S0HX45 | 68-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.