DPCstruct | MC49481
Metacluster Properties and Pfam Annotations
| Number of structural domains | 478 |
|---|---|
| Mean domain length (aa) | 286 ± 66 aa |
| Standard deviation of domain lengths | 65.88 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 77.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 15.73 |
| Pfam Score | 67.30 |
| Assigned Pfam label(s) | CL0023- CL0552- PF04526- PF04597- CL0209 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I6L8L2 | 9-212 | LRRELLNTYEQLGKSGLPFLDDIGKVDVKFGLSLQLLKSIEQRGMGFNSIGTFKAIVKLSWVDTILRWDPEPPFDFQKIEISPDEIW… |
| A0A6V4BHT1 | 242-532 | MLTVAIKVMKIIGIDEKAQTIDLILFIRMEWIMPDGSDPWIDWRDCLSWDTDQKPSKQLLPNGYTSETQTARVTFLQPLDLHHYPFD… |
| A0A5B7E0K6 | 473-829 | None |
| A0A162MLG3 | 262-539 | None |
| A0A7R9LJG4 | 1-195 | None |
| A0A7S4A009 | 351-671 | None |
| A0A3S0ZTC5 | 236-610 | None |
| A0A554UPF3 | 62-339 | None |
| A0A559QPM7 | 455-757 | None |
| A0A6G0X8W7 | 148-473 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.