DPCstruct | MC49479
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 85 ± 6 aa |
| Standard deviation of domain lengths | 6.43 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J1FJ66 | 1-73 | MLCTVTSDPAKEPLAVYRALKDFNTGWIQFIPIVRLTADGQPTADSVTGEGYGDFLCAVFDEWIRHDLGRLDV |
| A0A376V9G8 | 1-89 | MTGSQVIDAEEDRHKLVVEYKDALQPADFYHNFKQRGIRSVQLIPHLEFDDRGDLTAASVTAELWGKFLIALFECWVRADISRISIE… |
| A0A381FZY8 | 10-99 | None |
| A0A1V5FD02 | 1-89 | None |
| A0A090SB55 | 2-86 | None |
| A0A2X1PLR8 | 1-84 | None |
| A0A3S4IJ97 | 60-132 | None |
| A0A077Z957 | 95-185 | None |
| K1U2K3 | 26-114 | None |
| A0A5F1ECA7 | 1-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.