DPCstruct | MC49476
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 145 ± 23 aa |
| Standard deviation of domain lengths | 22.99 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05947 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376UF21 | 1-151 | MPVINLFPLEADPLHLSPLENEFLLRPMRIQDGHTEIYSVDNIISSRHTGSQAYVPFSSFRHRGGMLRHDAPERYYHTRVKRGPSGL… |
| A0A6J5DR42 | 67-207 | VGLFCTPIVNLFEHTGAKLSRGEIVADYPLVPKPNRPAMRGIYSIDAVRDPSDGAVIPSLNAWGTRTGERFWLARHDSYAAIHHPGR… |
| A0A1W9F0S4 | 1-145 | None |
| A0A2T5R345 | 495-620 | None |
| A0A485C5I0 | 110-251 | None |
| A0A2X1JM52 | 94-265 | None |
| A0A090RV07 | 177-313 | None |
| A0A4V1XRP7 | 480-600 | None |
| A0A182T653 | 3-139 | None |
| A0A3M5EDC7 | 179-327 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.