DPCstruct | MC49473
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 157 ± 32 aa |
| Standard deviation of domain lengths | 31.74 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 93.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 48.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376UC30 | 1-147 | MTSMFSCGTNERRMCDTIHPQIHDSDRLSMWRGNGEWICRPLNNPQKLQFNAYTDNNPKGFGLLQLDRDFSHYQDIMGWYNKRPSLW… |
| A0A4P1B2Y6 | 240-379 | TSMFLFGPNQPSPATNYRPALHDSNGLSILAGNGEWIWRPLNNPKHLAVSSYAMENPQGFGLLQRGRQFSRFEDLDDRYDLRPSAWI… |
| A0A844W8H0 | 82-182 | None |
| A0A655X0X0 | 117-299 | None |
| A0A3S4I022 | 171-250 | None |
| A0A377E431 | 1-199 | None |
| A0A6A5KY21 | 908-1070 | None |
| A0A1W6ZIV4 | 377-570 | None |
| A0A3M5YZ86 | 266-456 | None |
| A0A7X3U039 | 274-454 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.