DPCstruct | MC4947
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 113 ± 9 aa |
| Standard deviation of domain lengths | 8.88 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 72.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09775 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183CMB5 | 3-123 | GSNGFSALLSLLVVLSCIIVGQSFKALLAESRQGNLVAGGLGSVVFAFTLTAISNLKMANAGPSAKCGLFECGVALFFGVLSSASIH… |
| A0A5A7Q0S1 | 77-181 | AAGSSMLYSFLLFMATLSLQEMFRTKLASSELFTILGGFTSSIIFLMLLTFIGNYQETIGVKTGWGSVIIAEIVALIAASTVHRVCI… |
| A0A444T1K8 | 1-97 | None |
| A0A7M5V9H9 | 1-117 | None |
| A0A7J7GND1 | 118-233 | None |
| A0A3P7E5S2 | 1-108 | None |
| A0A0E0JL65 | 75-190 | None |
| A0A5J4VME2 | 41-152 | None |
| A0A5D2L0E3 | 35-144 | None |
| A0A0K9QY71 | 1-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.