DPCstruct | MC49466
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 72 ± 6 aa |
| Standard deviation of domain lengths | 6.32 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 58.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A381DCB2 | 32-103 | MASEEIGLNHYLEKKGLKAIETDLGELILQLNEEPPLHIVVPAIHRNRHEIGQIFKEKLGANLENDEPESLN |
| A0A7V2ALJ9 | 1-61 | SMVTEEIAINEHLAAAGIEPIETDLGEYIIQLRHEPPSHIIAPAIHLSKEQVAETFFQAHP |
| A0A376RPM6 | 1-72 | None |
| J6CIV4 | 39-110 | None |
| A0A377DHD2 | 1-72 | None |
| A0A0N0Z5I3 | 31-112 | None |
| A0A3S4VZI7 | 1-64 | None |
| A0A7C3WRQ1 | 83-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.