DPCstruct | MC49465
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 157 ± 20 aa |
| Standard deviation of domain lengths | 20.43 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D6PUC5 | 362-525 | LFPVVERPVPASDVPGEQAWPTQPIPVKPPPFVRTAFNENDISDLSPETRAAVKKEFDTLRSGTGFNPPSLKGTITVPGFHGGATWS… |
| A0A376U2M9 | 16-168 | PFSELSFRPKKDLSGADMWGATMFDQLVCRVMFHQMRYEGIFTPPSEQGTLVFPGNLGMFEWGGISVDPNREVAIANPMALPFVSKL… |
| A0A7H4PA28 | 509-690 | None |
| A0A7G8BFS9 | 320-476 | None |
| A0A699MPG2 | 2-119 | None |
| A0A1W9F3F3 | 14-169 | None |
| A0A377DXF4 | 1-128 | None |
| A0A7C7ZGG1 | 30-156 | None |
| Q025P1 | 866-1036 | None |
| A0A523INN4 | 583-741 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.