DPCstruct | MC49463
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 118 ± 10 aa |
| Standard deviation of domain lengths | 10.08 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 43.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00384 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376TZ02 | 1-119 | MGGKICGVNAAKIRELAALFHQNTTMLMAGWGMQRQQFGEQKHWMIVTLAAMLGQIGTPGGGFGLSYHFANGGNPTRRSAVLSSMQG… |
| A0A090R3P8 | 2-117 | LVNGRTQILVGWSIQRQEHGEQPYWMAAVIAAMVGQIGLPGGGISYGHHYSGIGVSSTGFAAPGSFPLNIDQGQEPKYTNQDFNGYS… |
| A0A090P661 | 107-243 | None |
| A0A8B4CTQ8 | 2-98 | None |
| A0A379GID0 | 6-120 | None |
| A0A376RLX4 | 3-114 | None |
| E8KKF7 | 2-120 | None |
| A0A376LRB1 | 42-164 | None |
| A0A7X7R9B1 | 2-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.