DPCstruct | MC4946
Metacluster Properties and Pfam Annotations
| Number of structural domains | 132 |
|---|---|
| Mean domain length (aa) | 121 ± 33 aa |
| Standard deviation of domain lengths | 33.28 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 85.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00830 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H2AP56 | 44-172 | PLYIPKKVAEFPDYKYGEPSVFKQSKKGLYGGSFIQFGHSISESKNKVKRRWLPNIVRKELWSEALNRRIRIKLTAKVLRTISKEGG… |
| A0A5A7PW12 | 37-166 | RKVVMGRAHRGLYAGRHIQFGNRVSEDGGNKTRRSWKPNVQEKRLFSYVLDRHIRVKITTHTLRCIDKAGGIDEYLLKTPYHKMDTE… |
| A0A1Q9CDQ1 | 133-240 | None |
| R7WIN1 | 26-127 | None |
| A0A6I9YLS9 | 38-213 | None |
| A0A0R4J8D7 | 80-192 | None |
| M1W980 | 1-170 | None |
| W7AMP2 | 91-170 | None |
| L0B0N8 | 32-176 | None |
| A0A5B6W6K5 | 1-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.