DPCstruct | MC49458
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 134 ± 20 aa |
| Standard deviation of domain lengths | 19.63 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05662 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376TPZ8 | 21-133 | VVITNVANGAISAASSDAINGSQLYTTNKYIADALGGDAEVNADGTITAPTYTIANAEYNNVGDALDALDDNALLWDETANGGAGAY… |
| A0A2X3JBD7 | 68-208 | RQIQNVAPGVLSINSTDAINGSQLFATNNQVSTNTGNIATNTANIAGNTTSINNLTNGTVGLVKQDQSTQAITVAGDKAGTSVNIAG… |
| A0A4V2BM93 | 1-106 | None |
| A0A376TQR8 | 150-267 | None |
| A0A6G3I549 | 297-442 | None |
| E6Z0T9 | 3-132 | None |
| A0A2P7ATL3 | 245-392 | None |
| A0A2X3ILX9 | 48-198 | None |
| A0A378MVA1 | 2-122 | None |
| A0A6B2BII6 | 105-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.