DPCstruct | MC4945
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 154 ± 16 aa |
| Standard deviation of domain lengths | 15.68 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07589 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X1EAD3 | 20-162 | AGLANSSLHLRILTIQEGETTFDADQGTALVGSAVEYPELVGEEGDLFAIPVAVDLSDSTITFDFSKLGDGEFAPGDFNGYVISDYQ… |
| A0A7C2IJ68 | 1-140 | MTFRVIAYDDPARPLFDGVGETVKVGRGVEFGLYPEGAQNGLDVIPAQVNIAADRVEVTWPFAGTGTVMEAAFNGYELRFETGCVLI… |
| A0A369XKM6 | 37-216 | None |
| A0A545TLC2 | 83-259 | None |
| A0A1G1LSL2 | 19-153 | None |
| A0A6M0ABB4 | 67-205 | None |
| A0A1M5TBG3 | 4-144 | None |
| A0A7C1URL7 | 16-205 | None |
| A0A661NDH9 | 102-251 | None |
| A0A2T1CIE1 | 695-846 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.