DPCstruct | MC49441
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 91 ± 8 aa |
| Standard deviation of domain lengths | 8.41 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 95.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 48.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G2IK38 | 184-282 | FELGNGDIARGTVLAFEAGVLDVPFAPAACNAGKILPVRDNTGAIRILEAGAVPLPKDILALHHDYVAERAHFEGRKPSFQMVIDDI… |
| A0A376SQN1 | 8-91 | DIARGTVLAFEAGVLDVPFAPAACNAGKILPVRDNTGAIRVLEAGAVPLPKDILDLHHDYVAERARCEGRQPTFQMVVDDINAV |
| A0A645GKK5 | 32-130 | None |
| A0A7C6T2D9 | 2-83 | None |
| A0A1F4EYB3 | 256-343 | None |
| A0A7H4NN52 | 91-189 | None |
| A0A7V7C2Z5 | 65-162 | None |
| A0A7Y3AFW3 | 3-82 | None |
| A0A7C5JIF8 | 13-91 | None |
| A0A0U1HKQ9 | 583-681 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.