DPCstruct | MC4944
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 184 ± 42 aa |
| Standard deviation of domain lengths | 41.91 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 76.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7W795 | 23-250 | QKREVSVEELIDLEQQAEFFIVLGQDAAAIDLLMGHLRSTSGTSPLPYLKLLEIYKRRGDRSDYERLRERFNSRFNAYAPAWETDLL… |
| A0A7C6VLT8 | 1-154 | VTEEHKSAIELADIMMSFGRVQGAAETLAEFIRGNPREAVTPWLKLLEVYRAAGLRAEFDAIAGELNKTFNVNAVNWDNYQLLRAAR… |
| A0A2N2S5F2 | 128-284 | None |
| A0A1G3HGA7 | 261-397 | None |
| A0A3S9HME3 | 108-246 | None |
| A0A433BHH7 | 381-630 | None |
| A0A011P298 | 1-146 | None |
| A0A7Y4XE14 | 372-525 | None |
| A0A849UH35 | 394-552 | None |
| A0A1L6FA19 | 194-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.