DPCstruct | MC49437
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 172 ± 22 aa |
| Standard deviation of domain lengths | 22.19 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 46.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376S9L9 | 29-203 | TQAINLIGEHKPSVPARTMAALACIAQNDSQQLLDEIVQQEGLEYATEVVIARQFIARCYESDPLLVTLQYQDEDYGYGYRSETYNE… |
| Q32EI9 | 105-282 | AQSDAALLWGFWNSYSQDELVDDLVIRCGLESAVEIALLALQLKYKPVKGAVTTIIPPNHEAESLPSWHQRLCHHLSLASEDEWQRC… |
| A0A376ZGH9 | 76-286 | None |
| A0A376Y6U6 | 89-286 | None |
| S1EIR3 | 219-394 | None |
| A0A6N8MVU5 | 3-150 | None |
| A0A376VH65 | 1-155 | None |
| A0A2S8BJC1 | 181-330 | None |
| A0A6G3I5M9 | 71-270 | None |
| D7XHF3 | 94-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.