DPCstruct | MC49436
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 93 ± 13 aa |
| Standard deviation of domain lengths | 12.99 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 28.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V6AR74 | 138-222 | LDPIKILDKPFDVVAQHIVGIVALAPASADSIYQLITRARPFDDLPRQEFDRVLNYLEGGGEALAGQYRGVFGKISVGNDDMVCD |
| X8FBF4 | 190-278 | GQIETMRVPANPLDILAQHTVAAAALEPLDADQWFDTVRRSASFAPLPRSVFEATLDLLSGKYPSTEFVELRPRLVYDRGTGTLTAR… |
| A0A7C2YY98 | 46-156 | None |
| A0A2V7X8U5 | 1-83 | None |
| A0A658K6T9 | 5-84 | None |
| A0A7Y8B7Y6 | 40-127 | None |
| A0A377CHI5 | 66-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.