DPCstruct | MC49432
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 112 ± 7 aa |
| Standard deviation of domain lengths | 6.85 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 32.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00771 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376RNA9 | 1-123 | MGYQVIDSASVIATHVNKIVRSYIPDLFNYDDITQLHNRLASMAPRLAEDLSAVLNYSQLLKVYRALLTEGVSLRDIVTIATVLVAS… |
| T0DZM0 | 40-145 | VDPTTILVTHLLETIKAKSYELMGRQEVKAIIDATRERYSAVVDELIPDLMTLGEVQKIFQNLLKEKVSIKDRVTILETLADNARNT… |
| A0A1Q6V1E7 | 30-150 | None |
| A0A6L4ZP52 | 171-283 | None |
| A0A3M5NUB6 | 199-301 | None |
| A0A800C6J1 | 335-439 | None |
| A0A7C3R7K5 | 43-150 | None |
| A0A090T1Z1 | 116-228 | None |
| A0A6I1ZJH2 | 251-362 | None |
| A0A6L5C5S0 | 456-572 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.