DPCstruct | MC4943
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 123 ± 12 aa |
| Standard deviation of domain lengths | 11.74 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 33.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09539 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A258CG14 | 2-127 | RLAALILALSLSALALPAQAQERTPAQRQTLADIAYVLGESHALRQACEGAYDQYWRDRMMRVTDTEAPDATLDRRLKESFNSGFAS… |
| A0A1G9MLP3 | 67-171 | STQQRDVGDTERALPYLAYTLGELHYLASACEGLDSQAWRQRMIELLAMEAPEPGRRRDRMIESFNDGYRVQQRRRPVCGEEVEIER… |
| A0A357LGA1 | 2-123 | None |
| A0A4P7F9H6 | 39-172 | None |
| A0A4Z0NIP1 | 161-300 | None |
| A0A3B0SZC7 | 17-146 | None |
| A0A7W5Z1C3 | 25-153 | None |
| A0A4Q9VHQ7 | 19-143 | None |
| A0A840E2T0 | 1-104 | None |
| A0A062U9Q7 | 2-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.