DPCstruct | MC49429
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 70 ± 3 aa |
| Standard deviation of domain lengths | 3.28 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 93.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 67.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00384 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H4P710 | 1-65 | MPTLDNPVETSISMFMWTDAIERGAEMTALRDGVRGKDKLDIPIKMVWNYAGNCLINQHSEINRT |
| A0A0B8P3V6 | 425-490 | RFPTLSNPIKASIPMFLWTDAIVRGTEMTDLTDGVQGVNQLNSNIKFIWNYAGNCIINQHSDINRT |
| A0A663BLW9 | 1-73 | None |
| A0A0A2VYX2 | 424-495 | None |
| A0A2X3LY29 | 1-73 | None |
| A0A447JHS8 | 28-94 | None |
| A0A0B8PBX0 | 177-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.