DPCstruct | MC49426
Metacluster Properties and Pfam Annotations
| Number of structural domains | 436 |
|---|---|
| Mean domain length (aa) | 156 ± 29 aa |
| Standard deviation of domain lengths | 28.58 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1AWH1 | 2-93 | VQEIAQKIIATAKEKKAQDIYFIPKEKSYELHMRVGDARCLVDSYEFDVLAAVISHFKFVAGMNVGEKRRSQLGSCDYQHGEKVSSL… |
| A0A522USZ0 | 275-411 | KSNFPPIVKLVAMLVAEGSKARASDIHIEPRDKYVQIRFRVDGELQNVFKYQKDVHPSVVSRIKIISKLDITNRRTPQDGSTHVSFN… |
| A0A2W1TI54 | 538-709 | None |
| A0A2H0AGS7 | 30-157 | None |
| A0A7V3SYY2 | 353-520 | None |
| A0A3M3TUV9 | 1-150 | None |
| A0A812NCM1 | 68-218 | None |
| D9UJE2 | 2-128 | None |
| R6H5S4 | 91-227 | None |
| A0A545SCT3 | 4-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.