DPCstruct | MC49410
Metacluster Properties and Pfam Annotations
| Number of structural domains | 131 |
|---|---|
| Mean domain length (aa) | 114 ± 21 aa |
| Standard deviation of domain lengths | 21.43 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 23.94 |
| Pfam Score | 88.17 |
| Assigned Pfam label(s) | CL0633- PF03477- CL0339- CL0109 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1QC65 | 9-125 | CASCGRRYSTYERIEDVGLMVRKRDDSRDPFRREKVTAGILKATKNRPVSEFQVEELVDRVEERLRRKGPEVTSQQVGIEVLQQLRN… |
| A0A837DW88 | 12-98 | MKRPESVIKRDGYRMPFASYKLKYIFSALGLEDQSDELICSVINKFGDQETVETAEIYDAVIATLKENNFDDEAESFITKHKVREEE |
| A0A7T9I1T0 | 8-101 | None |
| A0A534I0M6 | 82-190 | None |
| A0A1I7G7B7 | 14-149 | None |
| E7GEL9 | 15-128 | None |
| E7FHX6 | 2-97 | None |
| X1D169 | 10-111 | None |
| A0A523W638 | 24-123 | None |
| A0A1V3WGW3 | 5-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.