DPCstruct | MC49407
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 119 ± 14 aa |
| Standard deviation of domain lengths | 14.35 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 34.71 |
| Pfam Score | 96.67 |
| Assigned Pfam label(s) | PF02814- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378A8S9 | 154-274 | MVIKGGMINWALMGDPNASLPTPQPVFYRPMFGAMGKTLQDTCATFVSQAALDDGVKEKAGLERQVIAINNCRSVTKRDLVRNSATP… |
| A0A7W1K1Q3 | 1-102 | VHGAEPTRYGPDWGATGAAPAALSTTFVSAAALDAGISRTLGTRRRLIAVRGTRSIRRDDLARNRTVPEIDVSPEDGTVTLDGQVLR… |
| A0A066YSE0 | 913-1033 | None |
| A0A2I9DBP4 | 604-722 | None |
| A0A7W4EXU7 | 1-86 | None |
| A0A6A3B9W3 | 448-575 | None |
| G8S4B6 | 403-521 | None |
| A0A7K2XYX2 | 167-283 | None |
| A0A377LS75 | 1-98 | None |
| A0A8A3T7U5 | 439-569 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.