DPCstruct | MC49404
Metacluster Properties and Pfam Annotations
| Number of structural domains | 95 |
|---|---|
| Mean domain length (aa) | 224 ± 41 aa |
| Standard deviation of domain lengths | 40.56 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.64 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0277- PF04777 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1RVU2 | 42-251 | VQLEDLKSTISYMLFQEVPRRQVIDGDDLVGLKSWIHALAKYAPGTTPIRRLLYRMDQWLQQQGPSMSYDDWTKKLEQVHVDLGNPL… |
| A0A816C7U2 | 491-720 | FEAVKAWLNVLHMYYPGSETMNNFLSNLIEFMNNRTTLSSQELKHYINSISTIKLPNIKYDHCNGSDSSKRGYPCSLWVLFHSMTVK… |
| A0A0D8XVB3 | 239-460 | None |
| A0A6I9YY43 | 57-271 | None |
| A0A7S1UJT1 | 1-148 | None |
| A0A0K0E7E0 | 928-1165 | None |
| A0A7S1VCJ0 | 24-280 | None |
| A0A7S1UP45 | 359-656 | None |
| A0A812Y2P7 | 606-865 | None |
| G4ZR23 | 2-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.