DPCstruct | MC4940
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 390 ± 84 aa |
| Standard deviation of domain lengths | 83.87 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 86.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 14.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09481 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V8SR02 | 509-992 | LLAILHDAVDGPVDQEDWERLWQAKDPFGGVPEYLERHRERFDLLHPEQPFFQVAGLHTAKHEVSPLNRIVADVPSGEAFFSMRRPG… |
| A0A645BK82 | 7-388 | SISPAEAARWLIHCQAYDISGIKSGAVGDDRVKGGKGYPIGNGWAGWLGGITVTGSSLRETLLLNFVANSYQDDDLPVWELPQLTSS… |
| A0A7H9EIV5 | 113-563 | None |
| A0A0Q4CSC7 | 1-391 | None |
| A0A356TQ06 | 1-312 | None |
| A0A7W5VKG7 | 4-348 | None |
| A0A1V5USN1 | 48-440 | None |
| A0A416P7Q9 | 6-265 | None |
| A0A1F1E9P5 | 14-395 | None |
| A0A4Y6UB91 | 26-362 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.