DPCstruct | MC494
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 174 ± 25 aa |
| Standard deviation of domain lengths | 25.40 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 26.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S7QPK9 | 274-433 | VPSRSFSSTQPQNARRATRQRRQMYQWLSAQGEAFRNPLPNSTNYMGAYSPSGQLLRAADARKADGAPQSTEDETSSNRNANLPKEQ… |
| A0A286URL4 | 1-132 | MSIRLTPRPRLPSFQVCPQHTFSRGIRLPKKSVGDDVNVWLKGPGSVYEYPINGPNWLSGNRTFPFPMNPSFKPPAPISDKTKSELY… |
| A0A165H4J3 | 1-182 | None |
| D4ARC9 | 1-174 | None |
| S3DSU8 | 1-227 | None |
| A0A0E9NKU9 | 84-239 | None |
| A0A5N5QTU2 | 39-190 | None |
| G4TBN5 | 13-168 | None |
| C5M6J5 | 1-168 | None |
| U4LL15 | 283-445 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.