DPCstruct | MC49399
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 105 ± 15 aa |
| Standard deviation of domain lengths | 15.38 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A816AWZ4 | 1-112 | MFPIISSQGQHRTNAESQAVCYEVINSPNNDTIWSEAGLDMNIDWVTKCGNIVAYKLRWPTTGEWSDWFVVGVNDLSPVHTDKLTRM… |
| A0A1W0WG94 | 72-156 | QARCVLVNRTRTGDARWKANFSVQLDKLLLRGRIAAYNIRSFNGRWSDWFIPGYNDILTKFGSGCRMQRIWAMFHDHEFSYIFCQ |
| A0A8B6HK65 | 92-191 | None |
| A0A8B6ET74 | 1-128 | None |
| A0A2N6A328 | 390-475 | None |
| A0A819SNN9 | 1-90 | None |
| A0A3E0AP14 | 354-449 | None |
| A0A1D1VYC5 | 365-480 | None |
| A0A5J4F958 | 29-133 | None |
| A0A250IZ65 | 1-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.