DPCstruct | MC49397
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 73 ± 4 aa |
| Standard deviation of domain lengths | 3.77 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 80.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 52.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05699 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A816A2Z6 | 1-80 | LETCFGNFIDHPFVNPTIFWKEYGIDLPLLSSMARCYLSAPATSVQSESAFSISAHYGRKERARLSPENLAMSVFLKDKI |
| A0A817RQP9 | 75-144 | DKDEHSFSTFWKTYERSLPLLSKMARRYGSITASSVPSESSFSIAGYVARKNRSSLSAKNLKYSMFLKDK |
| A0A815YHB2 | 132-201 | None |
| A0A815RAE4 | 80-149 | None |
| A0A818EX50 | 1-76 | None |
| A0A814KMA8 | 1-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.