DPCstruct | MC49389
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 312 ± 42 aa |
| Standard deviation of domain lengths | 42.14 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 15.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0686 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A317HQV3 | 50-366 | ATAVAAPRAKAKRPARVEGPPPAPLPLDPEMVARLVAFMTEREAIRLRRADGQPRPWTDDPILDNGHFCNVHREHDKVTRWIANHWV… |
| A0A5E3XAV6 | 619-914 | DSAAILRSLALSDLLIGLQFNDQARSDVSDIESFTWNGKRQNLLPTDKKFLSAVAQNLDMYLPFKELQPSAQRMRLVFQGQQKDALI… |
| A0A0G4HQ09 | 84-393 | None |
| A0A2D6E4A4 | 1-389 | None |
| A0A7S3ZZE1 | 66-441 | None |
| A0A7S3ZXS0 | 104-467 | None |
| A0A7S2SVT7 | 68-409 | None |
| A0A1R4HZZ1 | 2-247 | None |
| A0A6S8VZA2 | 2-236 | None |
| A0A3R7EFK8 | 3-287 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.