DPCstruct | MC49384
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 157 ± 21 aa |
| Standard deviation of domain lengths | 20.64 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W4RBR0 | 2-140 | RDAILAAVHSGDIEELRVAVEWNELRPHVGEEDVDDLISYWKRISGDGEGREILAVLGEILDCGYVALPIGNDVENNLVYVWPALAE… |
| A0A7W1AX92 | 8-152 | DADLPEPVRQMRLRLMEAARTGDLNRLRALMDEQPEPPAVSLGNAGDPIEYLKALATDAEGREILAILLEVLEAGFVRVQAGAPDEL… |
| F8CF55 | 292-459 | None |
| A0A5M8P971 | 19-191 | None |
| A0A1Q7BT01 | 61-190 | None |
| F6FTJ9 | 126-295 | None |
| A0A411YG34 | 314-456 | None |
| A0A397LUC8 | 380-530 | None |
| A0A421AK36 | 413-572 | None |
| A0A833D3M4 | 1-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.