DPCstruct | MC49383
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 173 ± 15 aa |
| Standard deviation of domain lengths | 15.40 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 35.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3NSJ1 | 3-176 | PRCEHDQLCLAPSSHAQPAGYARRTAQQLIAATRPSGRTPKPKSQGNAAPEASTFPAPLVLPGDDLSLDPKYDAQSLKSWLQEPERN… |
| W3WGI9 | 5-191 | QQCDHAELQYDTSPHAAGAGFKRPNADRRLAATTKSGRNPLAVGGIGEKALGELTSKSAADIAASFPGPLVLPNDHLDIDPKDPPQS… |
| A0A074YGK6 | 3-171 | None |
| G4ZU12 | 3-159 | None |
| A0A4R8TC88 | 6-190 | None |
| A0A484G351 | 20-204 | None |
| A0A4S9H7H9 | 1-158 | None |
| A0A4S8X383 | 1-156 | None |
| A0A2G7FG65 | 249-397 | None |
| B2AC67 | 1-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.