DPCstruct | MC49381
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 184 ± 23 aa |
| Standard deviation of domain lengths | 22.83 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 37.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4CAW1 | 324-551 | FTRNHCEGHDWYEEVLTHIKYGQRNAASVDPLQSDDATNMVIIGAMERRDRLDVVHDRLRLPRLDRVPYDVTILANGLEAEADRLRQ… |
| A0A6A3NGH2 | 10-208 | LSTINQLADRDDVNALMLKRCEMRVRLDLVHARMGLPTLLMTEMETDWDAILAVEEQQLHEEYGLDSYAASSQPEQDGTRDEQAVPL… |
| A0A6A4D8R3 | 67-237 | None |
| A0A6A4DM16 | 4-166 | None |
| A0A225WTK1 | 1-168 | None |
| D0NIP2 | 438-618 | None |
| A0A6G0QKP0 | 930-1100 | None |
| A0A6A3MQV7 | 1-165 | None |
| A0A6G0QLB9 | 526-728 | None |
| A0A6A3RB07 | 668-831 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.