DPCstruct | MC49380
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 286 ± 64 aa |
| Standard deviation of domain lengths | 64.26 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 87.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 23.63 |
| Pfam Score | 97.62 |
| Assigned Pfam label(s) | CL0125- CL0141 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3N6Q0 | 30-333 | KYAKAFGMDPDQLMTAVSKSTGVLSMTSRSQCTTNADCASKNDGSVCARRDGQYEGYCIPTWFGICHAWAPAAILEPEPNCAVEHNG… |
| D0RLV7 | 10-301 | TQGVFTPAPWPAPYWPTYQDSINVVWSQGQPSPAEKYAKAFGLDVKEFMDKVSKDNGVDSGSKRTKCSSDNDCASRTDGSKCAIREG… |
| A0A3A0ANR8 | 407-676 | None |
| A0A536DJ96 | 14-280 | None |
| D0NAC8 | 3-184 | None |
| D0N8A8 | 26-221 | None |
| A0A838EUY1 | 48-308 | None |
| A0A2P4YT18 | 33-318 | None |
| K3WTJ2 | 59-391 | None |
| L0DGK2 | 116-454 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.