DPCstruct | MC4937
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 293 ± 35 aa |
| Standard deviation of domain lengths | 34.50 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H4SAI8 | 42-293 | NPELPYDQAVLRQALASVRAAQLPPTRYKALLRQYWIVNATLDANISLEAWDPWRTAKQNQHVIFGVYDYYAKLYLAHPAQLRWMAF… |
| A0A7V8NF84 | 83-408 | VLERMLDRARAMDVPPRRYAALLWQHWLVRAADAAGIGLRDWDPAGGVERNERTVHAVYTFYGDLFLANPRLQWAGMANMIGPSLAG… |
| A0A163L6A0 | 48-398 | None |
| A0A317P0Z9 | 57-388 | None |
| D3V8L0 | 33-267 | None |
| A0A4R1WH80 | 5-303 | None |
| A0A848WWZ8 | 513-815 | None |
| A0A2U1ZKZ4 | 3-287 | None |
| A0A7C5J0J2 | 119-397 | None |
| G7H2Z6 | 225-517 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.