DPCstruct | MC49364
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 163 ± 12 aa |
| Standard deviation of domain lengths | 11.97 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 29.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A485KID6 | 1-135 | MAVSETTVRDDYPDGVYMLMVYNDRTMLTSVEHTNSDGTTDRVILTNHSLITTDGTVLVDSVGINTVEHSLPLGRRYMITGFAYEIL… |
| A0A6G0XB98 | 164-324 | PSCTPKSRENISMVSVFETALDPSGSTSYLLTTYVDEPSPALEVRIDSQSGATTVVVSKPMKLFISSQGVVSPADMNQLSWRFQTRP… |
| A0A397A084 | 324-473 | None |
| A0A485KCA6 | 205-377 | None |
| A0A1W0A7D6 | 60-225 | None |
| A0A6G0XMG6 | 692-863 | None |
| A0A6G0W3H6 | 49-220 | None |
| A0A1V9ZYA4 | 372-528 | None |
| A0A1V9ZNZ3 | 148-324 | None |
| A0A067CT89 | 134-305 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.