DPCstruct | MC49363
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 144 ± 13 aa |
| Standard deviation of domain lengths | 12.60 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 29.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13874 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A418AVF7 | 1-136 | MNAAAFAAANSPLDSLNGVRMAYTDPFQSRFKHMFYNAVDPSQKHLYSRPPHVGEKLWIQAQRDNPDPANLVPAAVVGFKELSTRIQ… |
| A0A1X6PB64 | 203-342 | PPALVALVKAVDPASATCALRTALYNVVPPGTGGRHVRPPDFEPRLWADAVERNPAPDALVPVQAVLFDDLAARTALQAERLGGHAG… |
| A0A453BL11 | 1-168 | None |
| R0GNX7 | 355-497 | None |
| A2DR32 | 54-187 | None |
| A0A177EBB3 | 356-483 | None |
| A0A0W0FB74 | 614-773 | None |
| A0A4Y1QPY1 | 10-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.