DPCstruct | MC49362
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 70 ± 7 aa |
| Standard deviation of domain lengths | 6.80 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 59.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0012 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E9G6W2 | 70-127 | FITELTLRAWIHTEDNKRRTLQRNDIAMAISKYDQFDFLIDIVPRDELKPQKAREETP |
| A0A834R2D2 | 75-143 | FIAELSLRAWINTEESKRRTLQRNDIAMAITKYDQFDFLIDIVPREETKPNKRPDASIVITNDNHYNYY |
| M7YP04 | 76-146 | None |
| A0A131ZTA2 | 25-101 | None |
| A0A7R8CG64 | 496-574 | None |
| A0A448XRZ0 | 75-143 | None |
| A0A4S8JPA1 | 24-95 | None |
| A0A843UDK4 | 249-322 | None |
| A0A2G2WM63 | 25-80 | None |
| A0A642VEM9 | 57-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.