DPCstruct | MC4936
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 88 ± 4 aa |
| Standard deviation of domain lengths | 4.42 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 90.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 39.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q4XYJ3 | 1-78 | MTTAEAAQQANRTERTIRIWCRDHDIGRRIAGGPWLVSRVALAMFLNGDEAALRAYLAGDRQSSSVLAYFAVHGLEEL |
| A0A0Q5BBC1 | 1-93 | MVSHCCLIPFDRREGISVEAAAEIAGKSVRTLRLWCEQHQIGRRVGGGPWVVSRPALEMLLNDDYSALAAYLAGDRGSPAVTSYFER… |
| A0A6L6VBB1 | 80-160 | None |
| A0A4Q3WE27 | 3-91 | None |
| A4YKI6 | 25-117 | None |
| A0A840GCN3 | 5-94 | None |
| A0A021XGA2 | 16-104 | None |
| B9J9D3 | 3-92 | None |
| H1KG97 | 2-88 | None |
| A0A0Q5ZE53 | 2-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.