DPCstruct | MC49357
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 184 ± 42 aa |
| Standard deviation of domain lengths | 42.27 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 71.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R6ZXU7 | 11-173 | GQPTDDSHISSNEDDEDDHAKSSAAEVTFEIVNGQIVLATNSLTVHEDELMQEDDEAETHSSAKEHPRLGRYLSGRRASKRWGYVET… |
| M7PB52 | 171-315 | GAPQVRVVNGKIVIDETSLQVDRRERDVNPDIEMELVEENDLSRKVNSASWGKREKSDRWSLEETQRFYNALSQWGTDFGVICKMFP… |
| A0A183SXI5 | 32-189 | None |
| B8CEW4 | 2-153 | None |
| A0A835R8Y1 | 164-319 | None |
| A0A2K1J0E1 | 102-298 | None |
| A0A7R9A4E7 | 239-381 | None |
| A0A1Y2HR51 | 92-281 | None |
| N4X9K2 | 169-313 | None |
| A0A507EQ64 | 368-604 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.