DPCstruct | MC49355
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 232 ± 38 aa |
| Standard deviation of domain lengths | 37.62 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R6Z1Y5 | 143-367 | SMSIDRLHDVIEASLYQLHNEDLTDTKRTFREAAADTLNDLVGHVRKSQADKTWTLVQKKHLSANIVLHDMMRTDPTTFESLIQLHT… |
| K3XCI8 | 92-333 | NDENTALLSVLPDCLATADTKVVGVLNIVENATNPDHVIKKAVESPLAFNSVLSLKMAGSGREIAEIAQLHTINRVMCASKPSKDTT… |
| K3WT01 | 419-607 | None |
| A0A067C840 | 597-897 | None |
| G4ZY15 | 331-549 | None |
| W2NW30 | 207-472 | None |
| A0A225WYZ5 | 103-334 | None |
| A0A662XRV8 | 194-394 | None |
| K3WWY7 | 421-585 | None |
| F0WFA2 | 133-442 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.