DPCstruct | MC49353
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 141 ± 31 aa |
| Standard deviation of domain lengths | 30.54 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 92.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 58.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0344 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S9E122 | 1-101 | MLPAIDDYYEPFTYDYQHLHNAPEGKYLPTARPRSLISGERMDKISWGPNWEELLGGEFEKRARDRNFEAMQKEMYGQFENTFMMYL… |
| A0A6N6XBP3 | 1-173 | VGFPNDWENQEKWKGGWIRKINGKLQPRMGNKALLLGKIFANPHLPGMDDYYEPFDFDYQTLHNAPADSKAQPIARPRSLITGQRMD… |
| A0A4P0Y518 | 50-221 | None |
| A0A1J5Q5R7 | 4-142 | None |
| A0A533IW78 | 51-221 | None |
| A0A379ACK6 | 1-90 | None |
| F9EIH6 | 51-221 | None |
| A0A0C2MKV8 | 28-227 | None |
| A0A377D117 | 1-145 | None |
| A0A1Z1WSB6 | 616-784 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.