DPCstruct | MC49352
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 190 ± 32 aa |
| Standard deviation of domain lengths | 32.41 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M3GBY3 | 28-193 | IGDINNIYESVFDYDAEITTYACRAGISVDGNDMAGKDAGQKQSPAQKMADAWDVTVSAFEMRSSYVGVYGTGTEIKNAENYDKVIQ… |
| A0A2R7SFF2 | 57-295 | LDSIAQLLDFINLRISKKREIKQLDLFAHGLVGTIEFGYELDKADSYRLRDAQAQMLKPEAFDLSAKIHSYACRTGLGIHADVHVSE… |
| A0A251ZT31 | 158-350 | None |
| A0A6D2GC98 | 202-404 | None |
| A0A2V3Y7Y5 | 5-149 | None |
| U2AFE9 | 7-147 | None |
| A0A3R8U5X6 | 248-421 | None |
| A0A1Q5TEM2 | 24-226 | None |
| A0A7U1QDL1 | 270-452 | None |
| A0A3D9RXP7 | 247-502 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.