DPCstruct | MC49351
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 333 ± 68 aa |
| Standard deviation of domain lengths | 67.94 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 74.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.87 |
| Pfam Score | 85.25 |
| Assigned Pfam label(s) | PF08426- PF03348 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M9VQ62 | 2-389 | ATRVGYALLFCVDAIAAWISLTPSLARSIEEWTYKYVQVQCIQQETCVGVLAVHRITFALALFHVVLALLLVDVHDTRNPRATIQNG… |
| A0A3P6CWF0 | 41-398 | KSLRARYIYGTIFLIINLCAWFIRDYAQKALTLLPHVSSCGPEGSHCFHTLGVLRVSLGCFIFFLIMFLSTWNTMKLHQAQNTWHSD… |
| A0A1P8B168 | 44-362 | None |
| A0A3B5KZU3 | 46-431 | None |
| Q6CAC8 | 2-388 | None |
| A0A7J6TUH6 | 37-390 | None |
| B4FY55 | 4-216 | None |
| A0A446MGZ6 | 10-249 | None |
| A0A091DTL2 | 171-570 | None |
| A0A4Y7JPI8 | 31-400 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.